Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
    • Discover the Best Ferry Deals and Special Offers for More Affordable Journeys ...

      August 12, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

  • Un’assicurazione di viaggio affidabile per una vacanza all’estero senza preoccupazioni

Travel & Lifestyle
Home›Travel & Lifestyle›Amanda Burt: Education: The Foundation for Success | Column

Amanda Burt: Education: The Foundation for Success | Column

By admin1
September 10, 2022
463
0
Share:

[ad_1]

I don’t know about you, but summer seems to go by faster and faster each year.

As a parent, I know how chaotic it can be to get kids ready to go back to school. Being a junior high school student this year has given me the opportunity to reflect on my children’s education so far. All my children are so grateful for the education they have received in this wonderful community. The skills and bonds formed at an early age laid the foundation for future classroom success and basic life skills.

Success is possible thanks to the dedicated teachers and support staff in your local school system who understand that early education sets the tone for your child’s development and decision-making skills.

Here at United Way of Northwest Georgia, we are committed year-round to improving the education, basic needs and health of everyone in our community. Education is one of our top priorities. 46% of our funding supports educational programs. Getting kids ready for kindergarten, grade-level reading by third grade, and graduating on time with career- and life-ready skills is critical to the success of our entire community. Our community focuses on education and support systems for children and families. It’s great to have one less thing to worry about this year, knowing that all our kids have a great education that puts them on the path to success.

We understand how important the next generation is to helping build a better future. So our summer was focused on literacy. It’s “Keep Kids Thriving”. United Way provides comprehensive support for children learning to read and write, and then learning to read and write.

United Way’s Keep Kids Thriving is a campaign aimed at providing young children with tools and resources to help prevent summer heat exhaustion. Every child and young person in our community should have the knowledge, skills and experience to succeed in school, work and life. Studies show that being proficient in reading and writing by the third grade is an important predictor of high school graduation and career success. The good news is that United Way can help bridge the gap and help students stay on track through their literacy efforts. !

This summer, United Way distributed 3,983 books to children to support healthy summer reading habits and prevent summer reading deficits. United Way of Northwest Georgia gives children access to books and enriching activities to improve their reading skills.

The United Way is also committed to the Youth United program. Youth United is your source for volunteer opportunities focused on high school students.

Led by the Youth Council, Youth United provides unique and impactful service projects to improve the lives of children and families in Whitfield and Murray counties. Youth United develops the next generation of philanthropic leaders by creating unique leadership and community engagement opportunities for young people in grades 9 through her 12.

The Youth United Council is made up of 14 high school students from Whitfield and Murray counties. The Council is a youth-led staff assistance program in which students work with community leaders and community service providers to identify and improve community issues through volunteer work. Youth United members were required to submit two letters of recommendation and were individually selected by the Volunteer Center Committee through the application process. Through their experiences as Council members, they are able to see the impact of their service to their communities and the United Way!

United Way of Northwest Georgia is one of seven organizations selected to receive leadership initiatives from the University of Georgia by the JW Fanning Institute for Leadership Development, a unit of UGA Public Service and Outreach. The Innovations in Community Leadership Initiative provides resources and technical support to communities and organizations in Georgia seeking to strengthen their leadership development efforts.

So, as Pete and Julian Dosche spearhead the campaign season for United Way, the gift of Northwest Georgia’s United Way is a long-term investment in the children of our community and a big one. Know that you will benefit. You are enhancing your school readiness and strengthening your family dynamics. preventing child abuse; providing mentoring, safe play spaces, tutoring and leadership development; Keep young people on track in school, work and life.

Happy new semester!

Live “United!”

Amanda Burt is president of the United Way of Northwest Georgia.



[ad_2]

Source link

Tagsbooksfamilygiftgoodhappyhealthhealthykidslifelivememynewnewsschoolsuccesssummertimetopwork
Previous Article

At the Rose House unites art, design ...

Next Article

Profit Singularity Ultra Edition Review (My Results) ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Science & Tech

    NASA adopts 10-year recommendation for planetary science, issues warning – SpacePolicyOnline.com

    August 19, 2022
    By admin1
  • Fashion

    72% of college students will buy fast fashion in 2022. Can ThredUP change wasteful practices?

    August 25, 2022
    By admin1
  • Fashion

    NYFW partner of Harlem’s Fashion Row and LVMH

    August 19, 2022
    By admin1
  • Travel & Lifestyle

    American students deserve a multilingual education

    July 7, 2023
    By admin1
  • Science & Tech

    Scientific Systems and Applications – The Virginian-Pilot

    August 15, 2022
    By admin1
  • Fashion

    Bin day: Why trash fashion still inspires designers

    September 1, 2022
    By admin1

You may interested

  • Science & Tech

    Bluetti Solar Generator Kits: Harnessing the Sun for Clean and Reliable Power

  • Science & Tech

    The University of Chicago South Side Science Fest was created to showcase countless fun pathways to the field.

  • Science & Tech

    5 science-backed habits of leaders with amazing mental health

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (22)
  • Health & Beauty (1,622)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,754)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Transform Your Home into a Winter Wonderland with Appleyard’s Luxury Christmas Décor Collection

    By admin1
    December 8, 2024

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy