Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Enrichissez votre expérience de lecture grâce à ces grands magazines français

      May 20, 2026
      0
    • Beyond the Clouds: Why This is NYC’s Most Immersive Experience

      May 14, 2026
      0
    • Entdecken Sie die besten Fantasy-Hörbücher für Kinder – voller Staunen und Hoffnung

      May 14, 2026
      0
    • Solve, Move, Win: The Nostalgic Thrill of the Classic Board

      May 14, 2026
      0
    • Beyond the Skyline: Discovering Boston’s Soul from 750 Feet

      May 14, 2026
      0
    • Découvrez le pouvoir du son à travers ces cinq récits à ne ...

      May 14, 2026
      0
    • Scopri i piani sanitari Premium per famiglie per la massima tranquillità a ...

      May 14, 2026
      0
    • Affordable Travel Protection Quotes for Your Next Global Vacation

      May 14, 2026
      0
    • Entdecken Sie preisgekrönte Kunsthotels und Boutique-Unterkünfte in Norwegen

      May 14, 2026
      0
  • Fashion
    • Rinnova il tuo guardaroba quotidiano con questi splendidi abiti midi di Pull&Bear

      May 14, 2026
      0
    • Capo essenziale dalla vestibilità squadrata e di qualità eccellente per una moda ...

      May 14, 2026
      0
    • Scopri la nuova collezione stagionale di top in cotone firmati

      May 14, 2026
      0
    • Premium Oversized Streetwear Shirts Featuring Bold High Definition Prints

      May 14, 2026
      0
    • Απαραίτητες μοντέρνες τσάντες ώμου για μια τέλεια κομψή καλοκαιρινή εμφάνιση

      May 14, 2026
      0
    • CREPSLOCKER: Your Ultimate Destination for Exclusive Sneakers and Streetwear

      May 1, 2026
      0
    • La guida dell'uomo moderno per padroneggiare il look casual perfetto

      April 28, 2026
      0
    • I cinque look in denim indispensabili per ogni guardaroba in questa stagione

      April 24, 2026
      0
    • Best Lightweight Football Shirts from Spain’s Most Passionate Clubs

      April 23, 2026
      0
  • Health & Beauty
    • Capsule di glicinato di magnesio puro per alleviare lo stress e garantire ...

      May 14, 2026
      0
    • Modern Hygiene Made Simple with Wype

      May 12, 2026
      0
    • GETKONG: Naadloze digitale gezondheidszorg binnen handbereik

      May 6, 2026
      0
    • GETKONG: Directe gezondheidszorg, overal en altijd

      May 6, 2026
      0
    • GETKONG: Geef je levensstijl een nieuwe impuls met mode en innovatie

      May 6, 2026
      0
    • GETKONG: Jouw weg naar welzijn, prestaties en een gezonder leven

      May 6, 2026
      0
    • Wype: Smarter Hygiene Solutions for a Cleaner and Easier Lifestyle

      April 23, 2026
      0
    • PetenKoiratarvike: Premium-Lemmikkiruokaa ja Hoitoa Jokaiselle Karvaiselle Ystävälle

      October 9, 2025
      0
    • Transform Your Skin with Dermstore’s Premium Vitamin C Serums

      September 18, 2025
      0
  • Science & Tech
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
    • Transformieren Sie Ihr Unternehmen Mit Sage: Effizienz In Höchstform

      January 31, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Enrichissez votre expérience de lecture grâce à ces grands magazines français

  • Scopri mobili belli e resistenti per ogni spazio esterno

  • Znajdź idealne opony do swojego samochodu w iParts

  • Everything You Need to Know About Specialized Travel Insurance Plans

  • Transforma tu cocina casera con estos hornos profesionales Balay

  • Ottimizza i tuoi costi energetici con le nuove soluzioni energetiche di E.ON

  • Najlepsze naturalne przekąski poprawiające codzienne samopoczucie Twojego psa

  • Inside the World of Espionage: The SPYSCAPE Experience

Science & Tech
Home›Science & Tech›Aaron Rodgers tinkers with the science of psychedelics. Drugs like ayahuasca can change the brain, but how?

Aaron Rodgers tinkers with the science of psychedelics. Drugs like ayahuasca can change the brain, but how?

By admin1
September 29, 2022
446
0
Share:

[ad_1]

Green Bay Packers quarterback Aaron Rodgers has been vocal about the positive benefits he’s experienced from using the Amazon hallucinogen ayahuasca. It has been suggested that it has rapid antidepressant properties that may help treat addiction.

However, Rogers maintains that ayahuasca is not a drug.

“It has hallucinogenic properties. [sic] ability,” Rogers said during a recent appearancePat McAfee Shaw,” explains the exact behavior of the drug. “But it’s not a drug. We’re talking about plants here.”

This isn’t the first time Rodgers has messed with science on the topic of health. It contains drugs such as (N,N-dimethyltryptamine) and harmine. Otherwise no one will drink it. That’s like saying that decaf coffee makes a good back-up player for espresso.

Psychedelics like ayahuasca are becoming increasingly popular — and not just among people like Rogers who can afford to travel to Peru. Interest in ‘magic’ mushrooms is exploding. It captivated Western viewers who were plagued by fatigue.

Based on the vast amount of psychedelic research, that seems to be the case. But how exactly is this achieved? What is your reason for changing your life?

A new paper in the journal Neuropsychopharmacology summarizes what we know and don’t know about the effects of hallucinogens on the brain. Peeking under the hood, two scientists at the Center for Psychiatric Research at the University of Friborg in Switzerland examined the available evidence to determine the doses needed, where in the brain these changes occur. or how long they last, and any of these changes. In fact, it has real therapeutic value.

Scientists believed that brain development almost stopped after a certain age. We now know that’s not true.

Much of this psychedelic research relies on a concept called neuroplasticity, or, as one article put it, the brain’s ability to “correct, change and adapt.” Scientists believed that brain development almost stopped after a certain age. We now know that’s not true. Drugs and other methods can induce changes in the brain at any age.

But experts still don’t fully understand how this happens on a neurological level. It is essential for developing tools (i.e. medicines) to maintain good health.

However, much of the research into psychedelic neuroplasticity has been done in animals rather than humans. Measuring changes in the living human brain is not easy, but by giving rats and mice psychedelic drugs and measuring the size of neurons before and after administration, we can see what is happening and what is happening. You can learn a lot about what is not.

One of the most important aspects of psychedelics is the shape of the molecule. Looking at the chemical structures of drugs such as LSD, psilocybin, DMT, and 5-MeO-DMT (also known as “toad poison”), they are all highly toxic to serotonin, a chemical widely used in the body. looks similar. Especially the biological processes that keep the brain online. As a result, serotonin has been linked to many psychiatric and neurological conditions such as schizophrenia and autism.


Want more health and science articles in your inbox? Subscribe to Salon’s weekly newsletter, The Vulgar Scientist.


Psychedelics are like keys in roughly the same shape (but not exactly) as serotonin. Close enough for these drugs to slip into “locks” or receptors within cells and exert downstream effects on genes that strengthen the growth of new brain cells and the connections between existing neurons.

Most brain changes appear to be related to brain-derived neurotrophic factor (BDNF). BDNF is a protein our body naturally produces to regulate our nervous system. Not only does it play an important role in memory, but it also appears to promote biological processes related to neuron growth.Psychedelics appear to increase levels of BDNF. In fact, introducing psilocybin into the mouse brain allows us to see this growth in near real time.

Our brains are filled with billions of neurons, each with long, dangling threads called dendrites. BDNF is like fertilizer for neurons, growing large, bushy dendrites and creating more connections in the brain. Healthy neuronal forests are associated with positive mental health, while conditions such as PTSD and depression are associated with low levels of BDNF.

Several lines of evidence suggest that hallucinogens can create feedback loops between different receptors and generate large amounts of BDNF. This effect can last for several days in what Swiss researchers call the “window of plasticity,” and can help humans become more responsive to treatments or recover from injuries such as stroke. Moreover, the effects seem to be long-lasting, lasting up to a month in some people.

However, “long-term experiences of anxiety and distress in a state of heightened plasticity can be detrimental,” warn the authors. In some cases, it can rewire the brain in unpleasant ways. This is a condition in which some of the effects of psychedelic drugs, such as hallucinations and psychological distress, persist long after the drug wears off.

“Neuroplasticity may play a role not only in the long-term positive effects of psychedelics, but also in their undesirable effects,” the authors warn. Thankfully, these side effects are relatively rare and can be managed by taking the medication in a safe environment or with a therapist or guide.

There’s still a lot we don’t know about the brain, not to mention when powerful hallucinogens are added to the mix.

These are some of the leading theories about how psychedelics alter the brain, but they are still theoretical. For example, DMT (the main ingredient in ayahuasca) may involve receptors other than serotonin, such as the sigma-1 receptor.

Certainly stronger evidence is needed, such as using human subjects. The more we investigate the effects of drugs on the brain, the more it becomes clear how this wonderful metabolic machine works uniquely.

You shouldn’t expect a football player like Rodgers to score touchdowns in a subject as complex as neuroscience. The proof is in pudding, and Rogers’ experience with drugs is valid. Only he can say whether his ayahuasca journey was positive or life-affirming, but we can argue for the correct term: “drugs” is not a dirty word. Hallucinogens are drugs, and these substances can tell us a lot about ourselves.

read more

About psychedelics and the body



[ad_2]

Source link

Tagsanimalsbodycoffeedrinkfootballgoodgreenhealthhealthylifemagicnewpeopleplantsswitzerlandthetimetravelyouyoutube
Previous Article

Social media reacts to Cincinnati Bengals QB’s ...

Next Article

Press Releases | Press | Chair’s Newsroom ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Travel & Lifestyle

    SVUSD Wins $100,000 Grant from Education Foundation

    November 18, 2022
    By admin1
  • Health & Beauty

    Stocks of health companies soar as minimum wage for caregivers suspended

    September 5, 2022
    By admin1
  • Fashion

    Best Emmy Dresses of All Time: 10 Red Carpet Looks We Still Love

    January 12, 2024
    By admin1
  • Fashion

    In the ‘Love Lies Bleeding’ Film, Strength Is Satirical

    April 3, 2024
    By admin1
  • Science & Tech

    SCSU Political Science Chair Discusses Poll Challenges

    September 21, 2022
    By admin1
  • Travel & Lifestyle

    A month later, Punjab state secretary with no medical education: The Tribune India

    August 29, 2022
    By admin1

You may interested

  • Science & Tech

    The Science Of Making And Keeping Friends, According To Friendship Experts : Life Kit : NPR

  • Science & Tech

    Russia is pulling some troops out of Ukraine to fight Ukrainians in Russia

  • Science & Tech

    Bluetti Solar Generator Kits: Harnessing the Sun for Clean and Reliable Power

Search

Categories

  • All (1,241)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,733)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (17)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,602)
  • Health & Beauty (22)
  • Home&Living (227)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,344)
  • Science & Tech (1)
  • Sports (30)
  • Technology (172)
  • Travel & Lifestyle (1,691)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Enrichissez votre expérience de lecture grâce à ces grands magazines français

    By techsmillion
    May 20, 2026
  • Scopri mobili belli e resistenti per ogni spazio esterno

    By techsmillion
    May 20, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Trauma Echo: Science and Public Uncertainty in the Data Century – Isthmus

    By admin1
    August 29, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy