Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Discover the Best Ferry Deals and Special Offers for More Affordable Journeys ...

      August 12, 2026
      0
    • Descubre Nueva York junto a otros en las visitas en grupo al ...

      August 11, 2026
      0
    • Au-dessus des lumières de la ville : des expériences inoubliables à l'One ...

      August 8, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

  • Erfrischen Sie sich, tanken Sie neue Energie und meistern Sie Ihren Tag mit dem Faxe Kondi Energy Booster

  • Discover the Best Ferry Deals and Special Offers for More Affordable Journeys with Ferryhopper

Science & Tech
Home›Science & Tech›Aaron Rodgers tinkers with the science of psychedelics. Drugs like ayahuasca can change the brain, but how?

Aaron Rodgers tinkers with the science of psychedelics. Drugs like ayahuasca can change the brain, but how?

By admin1
September 29, 2022
486
0
Share:

[ad_1]

Green Bay Packers quarterback Aaron Rodgers has been vocal about the positive benefits he’s experienced from using the Amazon hallucinogen ayahuasca. It has been suggested that it has rapid antidepressant properties that may help treat addiction.

However, Rogers maintains that ayahuasca is not a drug.

“It has hallucinogenic properties. [sic] ability,” Rogers said during a recent appearancePat McAfee Shaw,” explains the exact behavior of the drug. “But it’s not a drug. We’re talking about plants here.”

This isn’t the first time Rodgers has messed with science on the topic of health. It contains drugs such as (N,N-dimethyltryptamine) and harmine. Otherwise no one will drink it. That’s like saying that decaf coffee makes a good back-up player for espresso.

Psychedelics like ayahuasca are becoming increasingly popular — and not just among people like Rogers who can afford to travel to Peru. Interest in ‘magic’ mushrooms is exploding. It captivated Western viewers who were plagued by fatigue.

Based on the vast amount of psychedelic research, that seems to be the case. But how exactly is this achieved? What is your reason for changing your life?

A new paper in the journal Neuropsychopharmacology summarizes what we know and don’t know about the effects of hallucinogens on the brain. Peeking under the hood, two scientists at the Center for Psychiatric Research at the University of Friborg in Switzerland examined the available evidence to determine the doses needed, where in the brain these changes occur. or how long they last, and any of these changes. In fact, it has real therapeutic value.

Scientists believed that brain development almost stopped after a certain age. We now know that’s not true.

Much of this psychedelic research relies on a concept called neuroplasticity, or, as one article put it, the brain’s ability to “correct, change and adapt.” Scientists believed that brain development almost stopped after a certain age. We now know that’s not true. Drugs and other methods can induce changes in the brain at any age.

But experts still don’t fully understand how this happens on a neurological level. It is essential for developing tools (i.e. medicines) to maintain good health.

However, much of the research into psychedelic neuroplasticity has been done in animals rather than humans. Measuring changes in the living human brain is not easy, but by giving rats and mice psychedelic drugs and measuring the size of neurons before and after administration, we can see what is happening and what is happening. You can learn a lot about what is not.

One of the most important aspects of psychedelics is the shape of the molecule. Looking at the chemical structures of drugs such as LSD, psilocybin, DMT, and 5-MeO-DMT (also known as “toad poison”), they are all highly toxic to serotonin, a chemical widely used in the body. looks similar. Especially the biological processes that keep the brain online. As a result, serotonin has been linked to many psychiatric and neurological conditions such as schizophrenia and autism.


Want more health and science articles in your inbox? Subscribe to Salon’s weekly newsletter, The Vulgar Scientist.


Psychedelics are like keys in roughly the same shape (but not exactly) as serotonin. Close enough for these drugs to slip into “locks” or receptors within cells and exert downstream effects on genes that strengthen the growth of new brain cells and the connections between existing neurons.

Most brain changes appear to be related to brain-derived neurotrophic factor (BDNF). BDNF is a protein our body naturally produces to regulate our nervous system. Not only does it play an important role in memory, but it also appears to promote biological processes related to neuron growth.Psychedelics appear to increase levels of BDNF. In fact, introducing psilocybin into the mouse brain allows us to see this growth in near real time.

Our brains are filled with billions of neurons, each with long, dangling threads called dendrites. BDNF is like fertilizer for neurons, growing large, bushy dendrites and creating more connections in the brain. Healthy neuronal forests are associated with positive mental health, while conditions such as PTSD and depression are associated with low levels of BDNF.

Several lines of evidence suggest that hallucinogens can create feedback loops between different receptors and generate large amounts of BDNF. This effect can last for several days in what Swiss researchers call the “window of plasticity,” and can help humans become more responsive to treatments or recover from injuries such as stroke. Moreover, the effects seem to be long-lasting, lasting up to a month in some people.

However, “long-term experiences of anxiety and distress in a state of heightened plasticity can be detrimental,” warn the authors. In some cases, it can rewire the brain in unpleasant ways. This is a condition in which some of the effects of psychedelic drugs, such as hallucinations and psychological distress, persist long after the drug wears off.

“Neuroplasticity may play a role not only in the long-term positive effects of psychedelics, but also in their undesirable effects,” the authors warn. Thankfully, these side effects are relatively rare and can be managed by taking the medication in a safe environment or with a therapist or guide.

There’s still a lot we don’t know about the brain, not to mention when powerful hallucinogens are added to the mix.

These are some of the leading theories about how psychedelics alter the brain, but they are still theoretical. For example, DMT (the main ingredient in ayahuasca) may involve receptors other than serotonin, such as the sigma-1 receptor.

Certainly stronger evidence is needed, such as using human subjects. The more we investigate the effects of drugs on the brain, the more it becomes clear how this wonderful metabolic machine works uniquely.

You shouldn’t expect a football player like Rodgers to score touchdowns in a subject as complex as neuroscience. The proof is in pudding, and Rogers’ experience with drugs is valid. Only he can say whether his ayahuasca journey was positive or life-affirming, but we can argue for the correct term: “drugs” is not a dirty word. Hallucinogens are drugs, and these substances can tell us a lot about ourselves.

read more

About psychedelics and the body



[ad_2]

Source link

Tagsanimalsbodycoffeedrinkfootballgoodgreenhealthhealthylifemagicnewpeopleplantsswitzerlandthetimetravelyouyoutube
Previous Article

Social media reacts to Cincinnati Bengals QB’s ...

Next Article

Press Releases | Press | Chair’s Newsroom ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Fashion

    “Avant-garbage” fashion at the CU Museum of Natural History

    September 6, 2022
    By admin1
  • Travel & Lifestyle

    A drug education group celebrates its anniversary by showing a fundraiser film.news

    August 30, 2022
    By admin1
  • Travel & Lifestyle

    First-ever National Survey Finds Millions of U.S. Students Denied Access to Music Education

    September 12, 2022
    By admin1
  • Fashion

    Hailey Bieber Street Style 2023: Bieber’s Most Stylish Looks

    August 29, 2023
    By admin1
  • Fashion

    Africa’s coolest fashion designers get dressed soon

    August 16, 2022
    By admin1
  • All

    Scott Bain Judge has announced plans to launch a dedicated team for e-commerce SEO services.

    August 27, 2022
    By admin1

You may interested

  • Science & Tech

    Charlie Jane Anders Picks Best Science Fiction of the Month

  • Science & Tech

    50 Years Ago, Scientists Dig into Pangea’s Past Lives

  • Science & Tech

    hit me with the best shot of science

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,752)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

    By techsmillion
    August 19, 2026
  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

    By techsmillion
    August 18, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Découvrez le confort et le style : Un aperçu de la collection exceptionnelle de canapés ...

    By admin1
    May 4, 2025

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy