Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Step Into a World of Secrets, Spy Skills, Interactive Missions, and Mystery-Filled ...

      July 3, 2026
      0
    • Explore Flexible Online Learning, Healthy Ageing Support, and Expert-Led Courses with Learning ...

      July 2, 2026
      0
    • Build Practical Skills, Creative Confidence, and Everyday Knowledge with Expert-Led Courses at ...

      July 2, 2026
      0
    • Compare Travel Insurance with Ease and Find Smarter Cover Options for Every ...

      July 2, 2026
      0
    • Compare Travel Insurance and Everyday Costs with PayingTooMuch

      July 2, 2026
      0
    • Discover Boston from Above with 360° Views, Memorable Keepsakes, Sunset Moments, and ...

      July 1, 2026
      0
    • One World Observatory: Dining, Events, and Skyline Views Above New York City

      July 1, 2026
      0
    • Discover New York from Above with Unforgettable Views, Special Offers, and Sky-High ...

      July 1, 2026
      0
    • Discover Smarter Ferry Deals and Easy Sea Adventures with Ferryhopper

      July 1, 2026
      0
  • Fashion
    • Un marchio di bottiglie eleganti e sostenibili, pensato per l'idratazione quotidiana, l'espressione ...

      July 4, 2026
      0
    • Discover Stylish Polarised Sunglasses, Everyday Eye Comfort, and Clear Vision with Feel ...

      July 2, 2026
      0
    • Find Stylish Everyday Eyeglasses, Comfortable Frames, and Personal Eyewear Choices at Fytoo

      July 2, 2026
      0
    • Discover Bold Nike Sneakers, Football-Inspired Streetwear, and Unique Preloved Styles at Crepslocker

      July 2, 2026
      0
    • Stradivarius Sports Shorts: Easy Style for Casual Everyday Looks

      June 21, 2026
      0
    • Stradivarius Sports Sweatshirts: Casual Comfort with Fresh Everyday Style

      June 21, 2026
      0
    • Trova il modello ideale tra queste splendide opzioni di abiti moderni

      June 9, 2026
      0
    • Camicie moderne perfette, realizzate per l'uomo dinamico e attento allo stile

      June 9, 2026
      0
    • Scopri i migliori abiti firmati per lasciare il segno

      June 9, 2026
      0
  • Health & Beauty
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
    • Refresh Your Everyday Hygiene Routine with Gentle, Sustainable, and Easy-to-Use Care from ...

      July 1, 2026
      0
    • Farmasave Wellness Picks: cura della pelle, alimentazione e supporto per la salute ...

      June 30, 2026
      0
    • Erfahren Sie, warum Patienten GETCONG bei ihrem Bedarf an medizinischem Cannabis vertrauen

      June 16, 2026
      0
    • Schnelle und diskrete Lieferung von medizinischem Cannabis in ganz Deutschland

      June 16, 2026
      0
    • Moderne digitale Lösungen für den Zugang zu professioneller medizinischer Cannabisversorgung

      June 16, 2026
      0
    • Scopri gli integratori più apprezzati per uno stile di vita attivo e ...

      June 9, 2026
      0
    • Wybierz zapach, który naprawdę odzwierciedla Twoją osobowość

      June 9, 2026
      0
    • A Modern Hygiene Solution for Everyday Freshness, Comfort, and Confidence Wherever Life ...

      June 7, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Un marchio di bottiglie eleganti e sostenibili, pensato per l’idratazione quotidiana, l’espressione personale e uno stile di vita eco-sostenibile

  • Il tuo punto di riferimento online di fiducia per salute, bellezza e benessere

  • Step Into a World of Secrets, Spy Skills, Interactive Missions, and Mystery-Filled Discovery at SPYSCAPE

  • Celebrate a Fun West End Musical Night with Tickets, Souvenirs, and Theatre-Inspired Gifts from Book of Mormon London

  • Discover Stylish Polarised Sunglasses, Everyday Eye Comfort, and Clear Vision with Feel Good Contacts

  • Find Stylish Everyday Eyeglasses, Comfortable Frames, and Personal Eyewear Choices at Fytoo

  • Explore Flexible Online Learning, Healthy Ageing Support, and Expert-Led Courses with Learning with Experts

  • Build Practical Skills, Creative Confidence, and Everyday Knowledge with Expert-Led Courses at Learning with Experts

Science & Tech
Home›Science & Tech›Aaron Rodgers tinkers with the science of psychedelics. Drugs like ayahuasca can change the brain, but how?

Aaron Rodgers tinkers with the science of psychedelics. Drugs like ayahuasca can change the brain, but how?

By admin1
September 29, 2022
466
0
Share:

[ad_1]

Green Bay Packers quarterback Aaron Rodgers has been vocal about the positive benefits he’s experienced from using the Amazon hallucinogen ayahuasca. It has been suggested that it has rapid antidepressant properties that may help treat addiction.

However, Rogers maintains that ayahuasca is not a drug.

“It has hallucinogenic properties. [sic] ability,” Rogers said during a recent appearancePat McAfee Shaw,” explains the exact behavior of the drug. “But it’s not a drug. We’re talking about plants here.”

This isn’t the first time Rodgers has messed with science on the topic of health. It contains drugs such as (N,N-dimethyltryptamine) and harmine. Otherwise no one will drink it. That’s like saying that decaf coffee makes a good back-up player for espresso.

Psychedelics like ayahuasca are becoming increasingly popular — and not just among people like Rogers who can afford to travel to Peru. Interest in ‘magic’ mushrooms is exploding. It captivated Western viewers who were plagued by fatigue.

Based on the vast amount of psychedelic research, that seems to be the case. But how exactly is this achieved? What is your reason for changing your life?

A new paper in the journal Neuropsychopharmacology summarizes what we know and don’t know about the effects of hallucinogens on the brain. Peeking under the hood, two scientists at the Center for Psychiatric Research at the University of Friborg in Switzerland examined the available evidence to determine the doses needed, where in the brain these changes occur. or how long they last, and any of these changes. In fact, it has real therapeutic value.

Scientists believed that brain development almost stopped after a certain age. We now know that’s not true.

Much of this psychedelic research relies on a concept called neuroplasticity, or, as one article put it, the brain’s ability to “correct, change and adapt.” Scientists believed that brain development almost stopped after a certain age. We now know that’s not true. Drugs and other methods can induce changes in the brain at any age.

But experts still don’t fully understand how this happens on a neurological level. It is essential for developing tools (i.e. medicines) to maintain good health.

However, much of the research into psychedelic neuroplasticity has been done in animals rather than humans. Measuring changes in the living human brain is not easy, but by giving rats and mice psychedelic drugs and measuring the size of neurons before and after administration, we can see what is happening and what is happening. You can learn a lot about what is not.

One of the most important aspects of psychedelics is the shape of the molecule. Looking at the chemical structures of drugs such as LSD, psilocybin, DMT, and 5-MeO-DMT (also known as “toad poison”), they are all highly toxic to serotonin, a chemical widely used in the body. looks similar. Especially the biological processes that keep the brain online. As a result, serotonin has been linked to many psychiatric and neurological conditions such as schizophrenia and autism.


Want more health and science articles in your inbox? Subscribe to Salon’s weekly newsletter, The Vulgar Scientist.


Psychedelics are like keys in roughly the same shape (but not exactly) as serotonin. Close enough for these drugs to slip into “locks” or receptors within cells and exert downstream effects on genes that strengthen the growth of new brain cells and the connections between existing neurons.

Most brain changes appear to be related to brain-derived neurotrophic factor (BDNF). BDNF is a protein our body naturally produces to regulate our nervous system. Not only does it play an important role in memory, but it also appears to promote biological processes related to neuron growth.Psychedelics appear to increase levels of BDNF. In fact, introducing psilocybin into the mouse brain allows us to see this growth in near real time.

Our brains are filled with billions of neurons, each with long, dangling threads called dendrites. BDNF is like fertilizer for neurons, growing large, bushy dendrites and creating more connections in the brain. Healthy neuronal forests are associated with positive mental health, while conditions such as PTSD and depression are associated with low levels of BDNF.

Several lines of evidence suggest that hallucinogens can create feedback loops between different receptors and generate large amounts of BDNF. This effect can last for several days in what Swiss researchers call the “window of plasticity,” and can help humans become more responsive to treatments or recover from injuries such as stroke. Moreover, the effects seem to be long-lasting, lasting up to a month in some people.

However, “long-term experiences of anxiety and distress in a state of heightened plasticity can be detrimental,” warn the authors. In some cases, it can rewire the brain in unpleasant ways. This is a condition in which some of the effects of psychedelic drugs, such as hallucinations and psychological distress, persist long after the drug wears off.

“Neuroplasticity may play a role not only in the long-term positive effects of psychedelics, but also in their undesirable effects,” the authors warn. Thankfully, these side effects are relatively rare and can be managed by taking the medication in a safe environment or with a therapist or guide.

There’s still a lot we don’t know about the brain, not to mention when powerful hallucinogens are added to the mix.

These are some of the leading theories about how psychedelics alter the brain, but they are still theoretical. For example, DMT (the main ingredient in ayahuasca) may involve receptors other than serotonin, such as the sigma-1 receptor.

Certainly stronger evidence is needed, such as using human subjects. The more we investigate the effects of drugs on the brain, the more it becomes clear how this wonderful metabolic machine works uniquely.

You shouldn’t expect a football player like Rodgers to score touchdowns in a subject as complex as neuroscience. The proof is in pudding, and Rogers’ experience with drugs is valid. Only he can say whether his ayahuasca journey was positive or life-affirming, but we can argue for the correct term: “drugs” is not a dirty word. Hallucinogens are drugs, and these substances can tell us a lot about ourselves.

read more

About psychedelics and the body



[ad_2]

Source link

Tagsanimalsbodycoffeedrinkfootballgoodgreenhealthhealthylifemagicnewpeopleplantsswitzerlandthetimetravelyouyoutube
Previous Article

Social media reacts to Cincinnati Bengals QB’s ...

Next Article

Press Releases | Press | Chair’s Newsroom ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • All

    Top career options to consider after engineering

    September 16, 2022
    By admin1
  • Fashion

    National Day for Truth and Reconciliation: Here’s How You Can Spend It

    September 29, 2023
    By admin1
  • All

    PTC Channel Chief Stuart Heavyside discusses the ‘big-scale’ SaaS opportunity and why digital marketing is key to partner success.

    August 16, 2022
    By admin1
  • Travel & Lifestyle

    UNM to receive $28.5 million for faculty positions donated by NM Higher Education Department: UNM Newsroom

    September 29, 2022
    By admin1
  • Travel & Lifestyle

    Jianzhi Education Technology Group Company Limited

    August 26, 2022
    By admin1
  • Travel & Lifestyle

    Well, Hawaii DOE collaborates with Amazon on cloud education

    August 31, 2022
    By admin1

You may interested

  • Science & Tech

    26th Annual Tennessee Girls in STEM Math and Science Conference Sept. 24 at MTSU

  • Science & Tech

    US to train Ukrainian pilots, maintainers on F-16s this fall

  • Science & Tech

    Security remains a challenge as Pentagon broadens 5G plans

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,747)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (19)
  • Gift Guides (52)
  • Gift Guides (23)
  • Health & Beauty (22)
  • Health & Beauty (1,614)
  • Home&Living (232)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (183)
  • Travel & Lifestyle (1,724)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Un marchio di bottiglie eleganti e sostenibili, pensato per l’idratazione quotidiana, l’espressione personale e uno ...

    By techsmillion
    July 4, 2026
  • Il tuo punto di riferimento online di fiducia per salute, bellezza e benessere

    By techsmillion
    July 3, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Acknowledge your dependence on Martech and build a better business case

    By admin1
    August 10, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy