Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Travel & Lifestyle
Home›Travel & Lifestyle›Charlie Christ’s Lieutenant Governor’s Choice Talks About Education at DeLand

Charlie Christ’s Lieutenant Governor’s Choice Talks About Education at DeLand

By admin1
September 25, 2022
407
0
Share:

[ad_1]

Carla Hernandez Matz, Charlie Christ's running mate for governor, will meet with Volusia County Democrats at DeLand headquarters Friday night. Before she was elected, she was president of the United Teachers of Dade and a former teacher.

DELAND — About 50 Volusia Democrats gathered at headquarters Friday night to meet Karla Hernández-Mats, one of the newest faces in the 2022 Florida election.

Charlie Christ’s running mate Hernandez Mats has been President of United Teachers of Dade since 2016 and is a first-generation Honduran Miami native. She hugged dozens of times, posed for countless photos of her, and talked about her humble beginnings before becoming a politician.

“I grew up in a very small house, much smaller than this one. Two bedrooms, one bathroom,” she said.

Roe vs. Wade Fall:Democratic nominee for governor Charlie Christ announces abortion rights firewall order

Charlie Christ:Spa Volusia, the new I-95 interchange near Spruce Creek Preserve

Courtship voters:Democrat Charlie Christo, Annette Tadeo mingle with black voters on B-CU campus

She had to share a bed with her grandmother, “my best friend” who was never given the chance to learn to read and write when she was a child. Nevertheless, her grandmother left an indelible impression.

“She taught me a lot about women’s rights, children’s rights,” Hernández-Matz said. “She started working in someone’s kitchen when she was nine.”

Hernández-Mats became a special education teacher.

“I did it because I wanted to be there for little girls like my grandmother,” she said. Let them know that they can do anything and be whatever they want to be.”

She is married and has two children, ages 13 and 8, who attend public schools.

Are you against school choice?

From endorsing school board candidates to defending parental rights to expanding access to private schools through scholarship programs, Gov. Ron DeSantis has made education central to his re-election campaign. rice field.

He also claimed victory in managing the pandemic, reopening schools to in-person learning in August 2020 when COVID deaths surged in Florida, earlier than many other states.

DeSantis’ allies fired ammunition at Hernández-Mats over a number of issues stemming from her advocacy as president of the teachers’ union.

In an op-ed published in the Orlando Sentinel earlier this month, Peyton Lofton, a policy analyst at the New Center think tank, criticized Hernandez Matz for not keeping in touch with her parents.

“She has a history of opposing school choice and the expansion of tax credit scholarship programs that would allow low-income students in Florida to purchase competitive private schools,” he wrote. .

“She also called for a complete end to funding charter schools, arguing ‘give to the haves and take from the have-nots,'” Lofton writes. “Perhaps Hernandez-Matz doesn’t realize that in 2021, 70% of her charter students in Florida will be minorities and 51% will be low-income.”

In a short one-on-one interview with The News-Journal on Friday night, Hernández-Mats addressed these criticisms.

She said she has no plans to abolish charter schools.

Democratic candidate for Lieutenant Governor Carla Hernandez Matz chats with Cynthia Slater, president of the NAACP's Daytona Beach chapter, on the porch of DeLand's Borussia County Democratic headquarters. Hernandez Matz, who is running in support of Charlie Christ for Governor Ron DeSantis, stopped by Volusia County on Friday night.

“All these different systems of schools and groups of schools are going to exist, and they have existed for a very long time. It was that we couldn’t provide it,” said Hernández Matz.

“Public schools are responsible for 90% of every child’s education, not only in Florida, but across the country. We need to secure funding, our public schools,” she said. “It’s not about eradicating anything.”

She reiterated her call for “accountability” for charter schools and private schools that accept state funding. These schools are not subject to the same grading system as public schools and are allowed to discriminate against students who identify as LBGTQ, students with same-sex parents, and gay teachers, she said. rice field.

The battle between ‘Don’t Say Gay’ and ‘Stop WOKE’

John Navarra, a Daytona Beach native and Democratic candidate for Congress in Florida and a high school social studies teacher, said he was “impressed” by Christo’s choice of educator.

“She knows firsthand what the teaching profession is like,” Navarre said Friday. “And there were a lot of laws that we didn’t ask for that were brought up to the teachers and had to be dealt with. was difficult.”

Dubbed by critics as a “don’t say gay” bill and being heavily pushed by DeSantis, the Custody in Education Act prohibits classroom discussions about sexual orientation or gender identity in grades K-3. I’m here. Appropriate. “

DeSantis also signed into law a bill called the “Stop the Wrons to Our Kids and Employees” or “Stop WOKE” law to stop significant race theory debates in public schools and Banned employment of CRT consultants.

Both bills give parents the right to sue teachers and schools they claim violate these laws.

Navarra said these laws were vague and could have serious consequences for teachers.

“If you tell me to lock the door, it’s easy to obey,” he said.

Hernández-Mats attacked the “parental rights” movement led by DeSantis.

“Teachers are being slandered,” she said. “Since when was it OK to ban books or censor teachers? It’s not OK.

“They’re distracting us and creating these fantastical situations about things that don’t happen, things that aren’t real,” she said. But we don’t let that happen.”

COVID response and experience

As Lieutenant Governor, Hernández-Matz is in a position to intervene on Christo’s behalf if Christo is elected and needs to be replaced.

Hernandez Matz, who has never held a state government job, said he was ready to take on the job of governor.

“I used to teach civics, so I understand how government works and how civics are educated,” she said.

Her job as president of the largest teachers’ union in the Southeast regularly sends her to Tallahassee to advocate for teachers and students.

Hernandez Matz said, “I think people may not see that side of me in the work I do, but I’ve been advocating in Tallahassee for many years. I got

“I also tell people that our schools and classrooms are a microcosm of our community. She said, referring to issues such as poverty, affordable housing and health insurance.

“I think I have a very different and unique perspective. I don’t even say it.”

DeSantis has been credited for his decision to require schools to reopen for in-person instruction in August 2020, while Hernández-Mats said, “Keep Florida schools closed during COVID. campaigned against it, but it hurt students and did essentially nothing to stop its spread,” Lofton wrote. .

Nationwide school closures contributed to lower reading test scores for the first time since 1990, with students of color showing the biggest drop.

Hernández-Mats defended her position on COVID, noting that DeSantis closed Florida with an executive order in March 2020.

“I mean, he put us on lockdown,” she said. “He likes to rewrite history sometimes, but he doesn’t want to admit it.”

She said she fought to keep students and teachers safe after it became clear that in-person learning would take place.

“It meant social distancing protocols. It meant wearing masks. It meant being more hygienic in our schools. And following CDC guidelines, scientists and protocols. We knew we had to do all these things because we were there,” said Hernández-Mats. “We weren’t gambling with our children’s lives. We wanted to make sure it was done right. I think it’s a credit to us for fighting hard to do it in the right way.”

Never miss an article: Subscribe to the Daytona Beach News Journal using the link at the top of the page.

[ad_2]

Source link

Tagsbeachbestblackbookscolorfallfridaygaygirlshealthkidslikesmemiamimynewnightrunningwomenwork
Previous Article

Italy’s Vatican Observatory, an educational tool that ...

Next Article

Climate Justice, Science, and Policy | Major/Minor ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Health & Beauty

    Dear Abby: Living with my husband is intolerable but … I dread hurting him

    September 24, 2023
    By admin1
  • Fashion

    A Run Down of Every Kylie Jenner Fashion Week Look 2024

    January 30, 2024
    By admin1
  • Fashion

    Skepta fit for Fashion Month

    September 29, 2022
    By admin1
  • All

    Scale Your Startup £12k Funding

    January 5, 2024
    By admin1
  • Science & Tech

    Boeing is using Fortnite’s game engine to upgrade B-52s

    September 22, 2023
    By admin1
  • Travel & Lifestyle

    Education, Student Loans, Taxes, State Fairs, History

    August 28, 2022
    By admin1

You may interested

  • Science & Tech

    UK, Latvia launch effort to send thousands of FPV drones to Ukraine

  • Science & Tech

    Detecting Disinformation in Summer Computer Science REU Program « News @ ODU

  • Science & Tech

    Anduril buys drone maker Blue Force Technologies amid Pentagon push for autonomous aircraft

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • 9th Annual Crow Wing Energized Health Summit Is Rooted in Happiness – Brainerd Dispatch

    By admin1
    September 11, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy