Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Health & Beauty
Home›Health & Beauty›Public Health Implications of Supreme Court Decision | News

Public Health Implications of Supreme Court Decision | News

By admin1
September 21, 2022
643
0
Share:

[ad_1]

Harvard Chan School forum panelists examined how a number of recent Supreme Court rulings are having a negative impact on public health and how their advocates can counter them

September 21, 2022 – “In just seven days last June,” Michelle Williams, dean of the Harvard TH Chan School of Public Health, said, “The U.S. Supreme Court set public health back 50 years.” That sober assessment, as Williams put it, “reduced efforts to address the immediate threat of climate change, expanded access to deadly firearms and, of course, eliminated rights,” according to a recent court decision. We kicked off a September 16th panel discussion at school focused on flipping Roe vs. Wade and aborting it.

moderate washington post Columnist Dana Milbank is a panel of experts who have tackled the impact of court decisions and the further threat of affirmative action and upcoming votes on voting rights. But the event was not all gloomy and devastating. Through discussion, participants will gain hands-on, inspiring insight into how public health advocates and the general public can work to mitigate the impact of some of the most alarming changes brought about by the courts. provided the words.

Attendees didn’t hesitate when Milbank asked each of them what words they would use to describe the current Supreme Court. was Her Cecile Richards, former president of Planned Parenthood and co-founder of Supermajority. Esther Sanchez-Gomez, attorney, Giffords Law Center to Prevent Gun Violence. Leah Stokes, Anton Bonk Associate Professor of Environmental Politics at the University of California, Santa Barbara.

“This is very partisan, and not just jurisprudence, [also of] Basic human rights and accepted standards in this country no longer protect people,” Richards said. while being influenced by Dobbs overturn the decision Law vs Wade State laws banning abortion continue to get backlash, she said. The decision also resulted in a major shift in public opinion that could help mitigate the impact. “This is a long-term re-shift in voter enthusiasm,” Richards said, adding, “This is a major concern for Texas and Mississippi.” It’s not an issue, it’s people’s belief that it’s an issue that affects every family in America.”

Public opinion on climate change also suggests a disconnect with the Supreme Court, Stokes said. She noted that polls show that 70% of Americans want action to curb climate change emissions. West Virginia vs EPA Limit the government’s ability to do so. “What we’re seeing is really a minority rule,” she said. She cautioned that courts apply the principle of “major issues”. “They could say anything was a major issue,” she said. The ruling wasn’t too bad, she added, because new provisions in the Inflation Reduction Act allowed the EPA to regulate carbon pollution.

On the issue of gun rights, Sanchez Gomez noted that “there is a lot of political will to talk about modest, common sense life-saving measures” to curb gun violence. denounced the Supreme Court’s ruling in New York State, revoking New York’s Concealed Carry Act and recognizing broad rights for citizens to carry guns in public. and went so far as to ridicule the ways it is proven to reduce gun violence, deciding to elevate his own ideologically biased anecdotes above public health research,” she said. . The Bureau of Alcohol, Tobacco and Firearms still has broad regulatory authority to set rules on gun ownership at the federal level, according to Sanchez Gomez, and advocates are taking the fight directly against gun manufacturers through lawsuits. .

In the next session, the Court will consider two cases in the field of racial justice that can directly affect the health of vulnerable populations: affirmative action in schools and race-based gerrymandering. . Discussing the latter case, which involved North Carolina’s re-election, and the state’s Supreme Court ruling unconstitutional, Morial argued that legislative re-election districts were somehow subject to judicial review. “I call it ‘Hocus Pocus Logic,'” he said. He warned that by adopting such a leap of logic, the court is jeopardizing its own legitimacy and its 50-year role in helping advance civil rights in American society.

Morial and other panelists asked the public to voice public opinion against the Supreme Court’s recent decisions and on abortion rights, gun control, climate control, and other issues that could lessen the impact of those decisions. “Frankly, until Republicans start losing elections because of the very issues we’re talking about, we need She also emphasized the importance of public health research showing the impact of abortion bans and other policies on public health: It’s so important to have a medical voice in this conversation about why it’s a medical issue, not a medical issue,” she said.

“We need to connect the dots to the fact that the erosion of our rights and public health is hurting us, and use that to really inspire our activism,” Stokes agreed. participants also stressed the importance of collective action to raise public awareness and pressure authorities to act. Stokes said. “Groups can help you plug in, they can help you go to protests, they can help you work on the bill. Don’t think you have to.”

– Michael Blanding



[ad_2]

Source link

Tagsamericacaliforniaeventfacebookfamilyhealthinspirelifenewnewspeopleschoolshowtexastheworkyou
Previous Article

‘Better and fairer future’: program advances diversity ...

Next Article

Ontarios today announced that it is expanding ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Science & Tech

    Get these science books at a discount with last-minute back-to-school deals

    September 13, 2022
    By admin1
  • Fashion

    Nss Magazine celebrates 10th anniversary with Milan Fashion Week party – WWD

    September 20, 2022
    By admin1
  • All

    How Your Digital Marketing Agency Can Grow Your Business With These 5 Ways — Hometown Station | KHTS FM 98.1 ...

    September 8, 2022
    By admin1
  • Science & Tech

    5 science-related anime to help you survive in school

    September 12, 2022
    By admin1
  • Science & Tech

    China tops the list of cited papers | Chemistry

    August 17, 2022
    By admin1
  • Science & Tech

    How science is getting closer to a world without animal testing

    August 14, 2022
    By admin1

You may interested

  • Science & Tech

    Science Links of the Week » Explorersweb

  • Science & Tech

    People in Your Neighborhood: La Jolla Teen Code Teaches Computer Science to Underprivileged Students

  • Science & Tech

    For foreign soldiers in Ukraine, US foundation provides lifeline to medical treatment

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (22)
  • Health & Beauty (1,622)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Digital Marketing Association of Sri Lanka helps revive tourism sector

    By admin1
    August 26, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy