Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Health & Beauty
Home›Health & Beauty›Mental Health Benefits of Replacing Social Media with Exercise

Mental Health Benefits of Replacing Social Media with Exercise

By admin1
September 15, 2022
500
0
Share:

[ad_1]

Two people jogging down a city street in the morningShare on Pinterest
Research shows that spending less time on social media and more time exercising improves emotional health and reduces stress.Thomas Berwick/Getty Images
  • Replacing social media use for 30 minutes a day with physical activity improves emotional health and reduces stress, according to German researchers.
  • The effects of exercise persisted for 6 months after the study ended.
  • Participants who used less social media and exercised more experienced greater well-being and less stress associated with the COVID-19 pandemic.
  • A decrease in social media use was also correlated with a decrease in tobacco consumption.

Lockdowns and contact restrictions due to COVID-19 have caused an explosion in social media usage. Millions of people turned to Facebook, TikTok, Twitter and other platforms to escape feelings of isolation, anxiety and hopelessness.

However, excessive screen time has led to addictive behavior, stronger emotional attachment to social media, and deeper emotional distress for many people.

Researchers at the Ruhr University in Bochum, Germany, investigated the effects of reducing social media use (SMU) and increasing physical activity, or both, on emotional health and tobacco consumption.

Dr. Julia Brailosvskaia, an assistant professor at the university’s Center for Mental Health Research and Treatment, led the two-week experiment.

Brailosvskaia and her team observed that the interventions they suggested may have helped participants increase their life satisfaction. At six-month follow-up, subjects continued to report spending less time on social media, staying physically active, feeling happier, and smoking less cigarettes.

of public health journal We recently published these findings.

The study’s authors said that mental health “comprises two interrelated but separate aspects: positive and negative.”

In this paradigm, they hypothesized that the positive aspects of the intervention “increase life satisfaction and subjective well-being.” On the negative side, it would reduce “depressive symptoms and dependency tendencies in SMUs.”

medical news today We discussed this study with author and nutritional psychiatrist Dr. Sheldon Zabrough. He was not involved in the study.

When asked about the impact of social media on mental health, Dr. Zablow affirmed:

“Activities are harmful if they interfere with the customary basic age-appropriate milestones of economic self-sufficiency, socialization, or health maintenance. , exercise choices, or entertainment choices, especially social media.”

Dr. Zablow warns that excessive social media use can weaken social relationships and negatively impact mental health.

MNT David A. Merrill, an adult and geriatric psychiatrist and director of the Pacific Brain Health Center at the Pacific Neuroscience Institute at Providence St. John’s Health Center in Santa Monica, California I talked about this research with Dr. He was not involved in the research.

Dr. Merrill argued that the term social media is “a bait-and-switch misconception” designed to “increase user engagement.”

Excessive social media use “can exacerbate” mental health problems in people with behavioral health conditions and addiction vulnerabilities.

“There is a reward system in the brain for clicking and scrolling and maintaining social media usage,” Dr. Merrill said.

“I think [that the authors are] It causally shows that we need to be consciously aware of the need to limit the self-soothing aspects of social media use, and that we also need alternatives, so we need another way to bring joy into our lives. Especially during a pandemic. ”

As a psychiatrist, Dr. Zablow emphasizes: Without exercise, psychotherapy and, if necessary, medication are ineffective. ”

Dr. Zablow added that exercise increases the production of neurotransmitters, the brain’s “natural antidepressant and anti-anxiety molecules.”

As a result, more exercise can build mental health, but reduced activity due to excessive social media use can compromise healthy brain chemistry.

Dr. Brailosvskaia and her colleagues concluded that “a conscious and controlled reduction in time spent in SMU and an increase in time spent in physical activity can causally reduce the adverse mental health effects of the COVID-19 situation.” We can reduce it,” he reasoned. They also thought that combining both interventions could amplify this effect.

The professor said the method would easily fit into everyday life with little cost, effort, or risk of violating COVID-19 protocols.

Additionally, scientists hoped their experiments would reduce stress caused by COVID-19 and reduce smoking behavior.

Researchers recruited 642 healthy adult social media users and divided them into four experimental groups.

There were 162 in the social media (SM) group, 161 in the physical activity (PA) group, 159 in the combination group and 160 in the control group.

Over a two-week period, SM subjects decreased their daily SMU time by 30 minutes, while the PA group increased their daily physical activity by 30 minutes. The combination group applied both interventions, whereas the control group did not change their behavior.

of the World Health Organization Physical activity recommendations For adults, the first three groups increased exercise time by 30 minutes.

Participants completed an online survey and a ‘daily compliance’ diary at the beginning of the study, 1 week, and 2 weeks later. We also submitted follow-up studies after her 1, 3, and 6 months of the experiment.

Dr. Brailosvskaia and her team concluded that their intervention helped people spend less time in SM.

Six months after the experiment, “participants still reduced their first SM time each day by about 37 minutes in the SM group, about 33 minutes in the PA group, and about 46 minutes in the combination group.”

Additionally, participants reported decreased emotional connection with social media.

All interventions also promoted more physical activity. “After 6 months, our participants increased their physical activity time during the first week by 26 minutes in the SM group, 40 minutes in the PA group, and 1 hour and 39 minutes in the combination group,” the authors wrote. increase.

Even the control group had a 20 minute increase in activity.

Dr. Merrill was impressed by the study’s “surprising findings of combining less social media with more physical activity.” He agreed with the idea that SMU restrictions require complementary activities that bring joy and fulfillment.

According to the authors of this study, the “experimental longitudinal design” of the current study allowed us to establish a causal relationship.

However, the study population lacked diversity. All participants were young women, Germans, Caucasians, and highly educated.

Dr Merrill said it would be “interesting” to replicate the study in the United States with a more diverse group, but felt the results would likely be similar.

This study did not consider the form of SMU being used by the subjects or specify the type of physical activity performed by the participants.

Dr. Brailosvskaia’s research suggests that moderate changes in SMU and physical activity can protect and enhance mental health in a convenient and affordable way.

The professor and her team see how SMU helps minimize segregation and disseminate information.

“Sometimes it’s important to consciously restrict access online and get back to our human roots. […] A physically active lifestyle to stay happy and healthy in the digital age,” the researchers wrote.

[ad_2]

Source link

Tagscaliforniadailydaydesignexercisefitfollowgermanyhappyhealthhealthylifelifestylenaturalnewssharetiktoktimewomenworld
Previous Article

The pandemic has boosted private education, but ...

Next Article

Highwire Public Relations Secures Strategic Investment from ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Fashion

    Elevate Your Wardrobe with the Season’s Hottest Dress Trends

    November 28, 2024
    By admin1
  • Fashion

    Mugler’s Must-Have Fashion: Where Comfort Meets Bold Style

    December 3, 2024
    By admin1
  • Health & Beauty

    Charlotte center offers care for the homeless

    August 15, 2022
    By admin1
  • Science & Tech

    Earth’s inner core appears to be slowing its rotation

    January 23, 2023
    By admin1
  • Science & Tech

    Science Links of the Week » Explorersweb

    August 13, 2022
    By admin1
  • Science & Tech

    Marquette Computer Science Professor Receives NSF Funding for Confidential Computing Solution // News Center // Marquette University

    September 12, 2022
    By admin1

You may interested

  • Science & Tech

    Opportunities for Technosignature Science in the Decade of Planetary Science and Astrobiology

  • Science & Tech

    The Rock Star of Science Was a Gentle, Playful Trickster

  • Science & Tech

    Letter: Medicine must embrace gene therapy to keep up with science

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • The Sky Experience: Engrossing Movies, Award-Winning Series, and Live Sports

    By admin1
    January 22, 2024

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy