Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

All
Home›All›Content Marketing Statistics 2022 Trends, Facts and Market Size

Content Marketing Statistics 2022 Trends, Facts and Market Size

By admin1
September 13, 2022
400
0
Share:

[ad_1]

Content Marketing Statistics 2022 Trends, Facts, Market Size and Revenue

WHAT WE HAVE ON THIS PAGE

Content Marketing Statistics: Content marketing has nowadays become regular in everyday corporate life. It is providing better access to company resources in the form of written content. Such information is once posted on the internet, and the audience can read it anytime they want. Such content writing includes videos, infographics, blogs, e-books, case studies, user-generated content, and much more.

What is Content Marketing?

Content marketing includes any written material and graphics that are focused on publishing the material and then distributing it to targeted audiences. Regular updates on the company’s website will increase visibility, brand image, engagement, and traffic towards it. While content marketing is hard to execute as continuous analysis should be applied in order for more growth, it can lead you to better results if all the pieces fall into place.

Advantages Of Content Marketing?

  • Business processes that use content marketing, have proved that there’s 30% growth in the businesses (Mailchimp).
  • Prospective buyers resulted in 47% checking the content on the company’s website before going forward with the company’s sale (Mailchimp).
  • Companies who post regular blogs on their website have more leads generated than those who don’t (Mailchimp).
  • 72% of digital markets informed that Business to the Business transaction has also increased upon adopting content marketing (Mailchimp).
  • Content marketing increases the trust in the eyes of the customer.

Importance Of Content Marketing?

  • With the use of content marketing, audiences are able to decide on which company to choose from.
  • Content marketing includes social media marketing and much more. Social media marketing gives wider access to companies in every corner of the world.
  • Technology is developing the marketing area, unlike traditional marketing, today’s digital marketing is cost-effective.
  • Companies can improve their brand image and awareness using social media campaigns.
  • Having involved content marketing, it is easy to measure the competitors’ steps which can harm the company’s progress.
  • Content marketing provides exact and accurate results in a timely manner
  • Social media allows 24*7 interaction with the consumers without any fees
  • Having involved in content marketing and creating a presence in the online world, will create trust between the customers and the company
  • Using technological advancements such as graphics, videos, and email it is easy to attract leads and turn them into buyers.
  • SEO analytics in content marketing helps companies rank their business on the first number of the search engine’s landing page. If any customer is unaware of the business, SEO analytics comes to the rescue as it is aware of the customer just by using keywords.
  • Considering the traditional media where once published ads can’t be altered and republished, on the contrary blogs can help you update the old content and renew it with new information.
  • While publishing and marketing any product or service companies had to pay a minimum amount to reach the targeted media. But in the digital business, companies can reach any audience using Pay per click strategy. That means advertising costs will be endured only when someone clicks on the link.
  • Using content marketing tools such as Google docs, Google keyword planner, WordPress, HubSpot, Google optimize, Canva, Coral draw, Adobe photoshop, Airtable, Hotjar, Brafton, and Ahrefs helps in many ways to increase the rank on Google’s search engine, SEO analytics.
  • Moreover, Social media accounts such as TikTok, WhatsApp, Instagram, and YouTube can help companies reach worldwide without spending any money. Also according to the monetary policies of each social media app, it gives the company a chance to earn passive income.

What Made Content Marketing Reach The Sky?

Those two pandemic years, when the whole world was shut behind the house door, improved the technological importance, therefore resulting in digital marketing. Digital marketing includes content marketing, where people all over the world are targeted. It is content marketing that saved the business during the pandemic period. Till today, the trend increased in such a way that now it has become a part of the company’s day-to-day activities. And now it has become an integral part of the company, ranking digital marketing as one of the top 10 in-demand skills in 2022.

Content Marketing Statistics (Editor’s Choice)

  • A widely used content marketing type is blog writing
  • Best ranked content marketing channel for distribution is the organic search
  • Mostly used analytics to base the content marketing is website analytics tools
  • One of the most useful strategies for effective content marketing is improving content quality
  • Digital marketers use to track the metrics is page views
  • 9% is the share of content marketers who don’t track metrics of content marketing
  • For business-to-business content markets leading analytics is changing into SEO/ search algorithm
  • One of the best investments for advertising in content marketing is video
  • It is expected to increase the content marketing budget for many companies globally resulting in around 42%
  • Around 37% of businesses are spending approximately $10,000 for richer experiences.

Worldwide Content Marketing Revenue

content-marketing-revenue-worldwide-from-2018-to-2026
(Source: Statista.com)

As seen above, content marketing revenue was barely reaching up to 50%. During the pandemic year, the percentage directly crossed 50% increasing the importance in all kinds of companies. Revenue is expected to increase more by the year 2026 crossing the number of 100%

Content Marketing Trends

Companies today are adopting content marketing included in digital marketing. New strategies are coming up every day to ease the business. Online marketing is helping companies to create brand awareness on an international level. Using Instagram, Facebook, YouTube, and WhatsApp companies can post videos, advertise, and promote their product or services, engage with customers, and many more possible things. The Internet is full of unbelievable things. A few months ago, Mark Zuckerberg announced the extreme change in the metaverse as it will let users engage on a higher basis with virtual reality. Today, companies are merely using social media networks to sell their products, tomorrow a 3D avatar will approach you to actually sell the product on behalf of the company.
(Source: Siegemedia.com)

At this moment, content marketing trends are increasing day by day, and it has offered some of the following data.

  • 46% of the companies have reported that they will increase their spending on content creation in 2022.
  • Content marketing by video channels has more demand than mere posts or photos.
  • In content markets, up to 61% of the markets are planning to increase physical events by the end of the year 2022.
  • Augmented reality (AR) and Virtual reality (VR) will see a rise in the budget by companies worldwide by 42%
  • Organic search contributes 51% to content marketing
  • 7% of content marketers are facing difficulties while continuously creating visual content.
  • Around the world, only 12% of content marketers are using voice search which is included in their strategy
  • 39% of companies are introducing infographics into their businesses for the first time ever.
  • Only 22% of the companies today support backlinks whereas 76% of content marketers are focusing on organic search as a base to measure content success.
  • In the year 2021, virtual events showed a high response than those physical events.
  • 59% of Content marketers use video as a way to communicate through social media.
  • Today 94% of companies have moved to social media to increase their brand awareness resulting in sales.

B2B Content Marketing Statistics

Business-to-business content marketing can be referred to as marketing that is focused on to appealing a business audience. B2B content marketing is also important as B2C is today. Businesses are helping businesses to increase their sale. There’s cutthroat competition even in B2B marketing. If a company wants other companies to get noticed, one has to show why business-to-business levels are distinct to do further business. Here social marketing techniques won’t work, as such networks are designed for individual audiences.
(Source: Siegemedia.com)

Following are the known B2B content marketing statistics

  • In B2B marketing, businesses use educational content and email campaigns at the percentage of 77% and 87% respectively to increase the important
  • 58% of content marketers reported an increase in outcomes with the use of virtual events in 2021.
  • In order to increase the relationship and loyalty, 63% of the marketers use content marketing strategies.
  • By the end of the year 2022, 33% of the B2B will increase their budgets in virtual events
  • Outsourcing in terms of content marketing has increased to 75% of large-scale businesses, 54% of medium-scale businesses, and 37% of the small scale industries
  • According to social media examiner, Twitter will gain more importance in terms of the need to be heard.
  • Chatbots are now being part of the businesses that promote automation resulting in 40%
  • Unfortunately, 47% of the companies don’t measure their return on investment in content marketing
  • Today in Business to business type when creating content only 66% of content marketers prefer a sales message over the audience’s expectation.
  • On the other hand, 88% of the always prioritize their audience over any other thing.

B2C Content Marketing Statistics

Contrary to B2B marketing, in B2C content marketing business is typically in contact directly with the customer. The activities performed on various platforms are aimed at the customers to market, promote and sell the products/services. Today customers prefer social media and those traditional marketing has reduced its importance. All of these happened during the pandemic year in 2020. When companies looked into the future of digitalization and aimed toward increasing brand awareness. Following data studies by various mediums tells us the importance of business-to-customer (B2C) content marketing.
(Source: Siegemedia.com)

  • In recent years top three content marketing which included 74% of emailers, 80% of short articles and blogs, and 94% of social media.
  • According to Conductor, only 40% of content marketers in the B2C market analyze their competitors.
  • Big corporate that value their customers have a big budget for content marketing resulting in up to 40%
  • On the other hand, an average company will contribute only 26% of the total budget.
  • By the end of the year, according to HubSpot 62% of digital marketers will shift to influencer marketing.
  • More than 50% of content marketers resulting in 55% outsourcing content marketing.

Summary

Looking at the above Content Marketing Statistics data it is clear that in the coming years every company around the world will include content marketing in their strategies. Companies have already understood the importance of digital marketing and slowly spreading their wings toward social media marketing. Content has gained utmost importance reaching 60% of the companies worldwide. More technological development will give rise to advanced digital marketing in the future.

Conclusion

Unlike traditional marketing, technology has introduced digital marketing in a fast few years. Many companies are slowly focusing their strategies on digital business and content marketing is trending in the market. Content marketing is extremely easy to use but difficult to handle. There are many competitors even in the online business. Online business has different rules and regulations which differ from country to country. And a company having business in international countries has to follow each and every rule to adopt digital marketing.

Digital marketing is the future of business. Right from sitting at the home, people can sell their products or services over the world. On the other hand, content marketing has created many job opportunities allowing people to work from home. Affiliate marketing, or content marketing, is one aspect of content marketing that helps people make passive income. To be honest, having a career in content marketing is extremely useful to grow a career.

Shivanjali Pawar

Shivanjali Pawar

Shivanjali, a Digital Marketing Expert, regularly contributes to various industry-specific magazines. She is interested in tech statistics, SMO, and raising awareness about technical how-to guides. She can often be found exploring different places on weekends.

[ad_2]

Source link

TagsBusinessdaydraweyesfallfollowhomeinstagramlifemarketingnewskysuccessTechtiktoktrendvideoworkworldyoutube
Previous Article

Get Pixabiz launches cheap website builder service

Next Article

Mayor Stevens Point and Aspirus Business Health ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Health & Beauty

    UK faces ‘humanitarian crisis’ due to rising energy costs, health lobby says

    August 19, 2022
    By admin1
  • Wayfair rolls out holiday shopping deals early and often

    October 20, 2023
    By admin1
  • Travel & Lifestyle

    JCPS School Board Celebrates District’s Academic Success

    September 19, 2022
    By admin1
  • Fashion

    Watch dozens of AI-generated fashion designs in captivating videos

    August 27, 2022
    By admin1
  • Science & Tech

    Emerald Coast Science Center weathers COVID pandemic and emerges stronger

    September 29, 2022
    By admin1
  • Travel & Lifestyle

    Spellbinding Sequel: Diving into ‘Harry Potter and the Cursed Child’

    November 12, 2023
    By admin1

You may interested

  • Science & Tech

    Has science evolved to record dreams?

  • Science & Tech

    BlackSky wins $1.7 million NASA contract to advance Earth science research

  • Science & Tech

    Bluetti Solar Generator Kits: Harnessing the Sun for Clean and Reliable Power

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • What Celebs Did and Wore on New Year’s Eve 2024

    By admin1
    January 2, 2024

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy