Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Discover the Best Ferry Deals and Special Offers for More Affordable Journeys ...

      August 12, 2026
      0
    • Descubre Nueva York junto a otros en las visitas en grupo al ...

      August 11, 2026
      0
    • Au-dessus des lumières de la ville : des expériences inoubliables à l'One ...

      August 8, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

  • Erfrischen Sie sich, tanken Sie neue Energie und meistern Sie Ihren Tag mit dem Faxe Kondi Energy Booster

  • Discover the Best Ferry Deals and Special Offers for More Affordable Journeys with Ferryhopper

Science & Tech
Home›Science & Tech›Alphabet’s health science company Verily raises $1 billion to help expand business

Alphabet’s health science company Verily raises $1 billion to help expand business

By admin1
September 11, 2022
456
0
Share:

[ad_1]

Verily Life Sciences LLC, a health sciences company spun off from Alphabet Inc., has raised $1 billion in a round led by Alphabet to help expand its precision medicine-focused business.

Founded in 2015 from Google X’s Life Sciences group, Verily’s aims to bring the promise of precision health to everyone, every day. The company focuses on processing and using data from a variety of sources, including clinical, social, behavioral and real-world to arrive at the best solutions for humans based on a comprehensive view of the evidence. .

Verily uses a data-driven, people-first approach to change the way people manage and deliver health care, using data science and technology to deliver better health outcomes .

One of Verily’s best-known products is Baseline, a service designed to make it easier for individuals to participate in clinical research. Baselines are used in various medical projects, including testing initiatives for COVID-19.

The new funds will be used to support various major initiatives. These include real-world evidence generation, healthcare data platforms, research and care, and the underlying technologies that power this work to improve healthcare outcomes for individuals. Verily said it would also consider further investments in strategic partnerships, global business development and potential acquisitions.

In addition to announcing the funding, Verily said founder Andy Conrad will become executive chairman of Verily’s board of directors, and current president Stephen Gillett will be promoted to chief executive officer effective January 2023.

Gillet joined Google LLC in 2015 and served as Resident Director of Google Ventures. In 2016 she moved to Google X (now X) where he was CEO of Chronicle, Alphabet’s cybersecurity company. In 2020 he joined Verily as Chief Operating Officer.

“These new positions are the result of thoughtful succession planning led by Conrad and the Board of Directors, and will position Verily as a more operationally and commercially focused company that executes on its precise health strategy. It’s a recognition of the skills and experience required to lead,” said Verily. statement.

Including new funding, Verily has raised $3.5 billion to date, including $700 million in December 2020 and $1 billion in 2019, according to Crunchbase. Third-party investors include Temasek Holdings, Silver Lake and Ontario Teachers’ Pension Plan.

Photo: Verily

Show your support for our mission by joining our expert Cube Club and Cube Events community. Join a community of celebrities and experts including Andy Jassy, ​​CEO of Amazon Web Services and Amazon.com, Michael Dell, Founder and CEO of Dell Technologies, Pat Gelsinger, CEO of Intel, and more .

[ad_2]

Source link

TagsbestBusinesscommunitydayhealthlakelifenewpartypeoplephotopowershowsilvertheviewworkworld
Previous Article

Go Beyond High School HBCU College Fair.education

Next Article

Explainer: Everything You Need to Know About ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Fashion

    Stuart Vevers Coach Creative Director on 10 Years with the Iconic Brand

    September 14, 2023
    By admin1
  • Travel & Lifestyle

    Education sector cancels $4 billion in ITT Tech student loans

    August 16, 2022
    By admin1
  • Science & Tech

    Indigenous people gather at science camp – Times Standard

    August 21, 2022
    By admin1
  • Technology

    Geschäftspotenziale erschließen mit Sage: Eine Suite von Lösungen für jeden Bedarf

    January 1, 2025
    By admin1
  • Travel & Lifestyle

    SVUSD Wins $100,000 Grant from Education Foundation

    November 18, 2022
    By admin1
  • Health & Beauty

    Dear Abby: Woman says husband of 43 years is a ‘nasty drunk’ and the situation is growing worse

    November 5, 2023
    By admin1

You may interested

  • Science & Tech

    50 million tons of water vapor from Tonga eruption could warm Earth for years

  • Science & Tech

    Sky Q Überprüfung: Erkundung seiner Funktionen und Vorteile

  • Science & Tech

    Scientific Systems and Applications – The Virginian-Pilot

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,752)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

    By techsmillion
    August 19, 2026
  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

    By techsmillion
    August 18, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Franciscan University and Trinity Partnership Strengthens Healthcare | News, Sports, Jobs

    By admin1
    August 26, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy