Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

All
Home›All›Caribbean Digital Platform Offers Labor Day Deals

Caribbean Digital Platform Offers Labor Day Deals

By admin1
September 2, 2022
416
0
Share:

[ad_1]

News Fort Lauderdale, Florida, USA, Friday. September 2, 2022: Hard Beat Communications, an award-winning Caribbean-owned digital PR and AD agency, gives any organization the digital marketing tools they need to grow their business from one dashboard with the click of a mouse We launched our own digital platform. A fraction of the cost of other digital agencies.

And this Labor Day weekend, businesses of all sizes can get started with their own dashboard and 8 free digital marketing software tools for a small subscription fee of US$30 per month. Social media platforms at once. Option to manage client meetings in one place. Software that manages reviews from a dashboard. The means to manage your brand’s digital growth and ensure your company is listed accurately across search engines, and the option to view and manage your clients on custom brand dashboards, including invoicing.

Digital Dashboard from Heartbeat
Hard Beat Digital Products.

Hard Beat also offers many other tools that you can add to grow your company’s brand through digital marketing.

A social media pro tool that allows you to manage and schedule social posts across multiple platforms.

Option to organically grow company listings on hundreds of sites. Tools for managing reviews and posting 5-star reviews on your site.

Option to let every team member get their own custom meeting link using a calendar software tool.

SEO for you

Create, manage, import and host websites including landing pages and e-commerce sites.

Design and create social media pages.

Content creation including blogging, website content, social media content and management, press release writing and global distribution.

Digital advertising purchases, including geofencing, and digital marketing consulting.

Brand design for flyers, powerpoint presentations, brochures, business cards and more.

with custom branded office videos;

Cybersecurity testing and malware removal.

Founded in 2004 by Caribbean immigrant Felicia J. Persaud and now part of the ICN Group of Companies, Hard Beat has gone fully digital since the pandemic, launching a dynamic digital platform to Grow at any scale through digital marketing without huge monthly maintenance and service fees.

“Unlike traditional AD and PR agencies, we offer every client at least $50 to grow digitally on the Heartbeat platform, with a unique dashboard to add services as we grow. It gives us the opportunity to operate like a large company,” said Persaud. “This takes a lot of the pressure off without a big upfront budget or the guesswork of digital marketing. You can see it in real time, as much or less than what they want to put in.”

Subscribe now or learn more on hardbeatcommunications.com or on social media (Facebook.com/hardbeatcommunications, Twitter). @hardbeatcomms or linked at linkedin.com/in/hardbeatcommunications



[ad_2]

Source link

TagsbrandBusinesscustomdaydesignfacebookfloridafreefridaymarketingnewsteamthetimetraditionalusaviewweekendwritingyou
Previous Article

Smithsonian Folkways – Digital Marketing & Distribution ...

Next Article

Learn to be an astronaut with space ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Science & Tech

    Will Earth ever leave the solar system?

    August 28, 2022
    By admin1
  • All

    Business Gateway Helps Digital Marketing Firms Achieve Net Zero Status

    August 24, 2022
    By admin1
  • Travel & Lifestyle

    Middlesex County welcomes ‘new era’ of education with rebranding with new name and logo

    September 8, 2022
    By admin1
  • Travel & Lifestyle

    Central Michigan Life – Conversations that Matter: CMU students and faculty discuss the politicization of education

    September 30, 2022
    By admin1
  • Fashion

    Discover Timeless Elegance with Rachel Jackson’s Stud Earrings Collection

    December 9, 2024
    By admin1
  • All

    Invest in these 5 technologies to redefine your marketing efforts

    September 2, 2022
    By admin1

You may interested

  • Science & Tech

    The Pentagon may never get to the bottom of that famous UFO video

  • Science & Tech

    CCNY Wins $26 Million for Mount Sinai Life Science Incubator

  • Science & Tech

    Power on Demand: A Deep Dive into BLUETTI Expansion Batteries

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • This Arctic fish has gills stuffed with antifreeze, scientists find : ScienceAlert

    By admin1
    August 18, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy