Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

All
Home›All›Data discourages digital marketing

Data discourages digital marketing

By admin1
August 25, 2022
403
0
Share:

[ad_1]

We believe that decisions are made based on data-backed facts and that the decision-making process is rational and logical. But what happens is fundamentally different. If you introduce data early in the sales cycle, it will create distrust and kill conversions on your website and digital marketing. This is caused by a strange psychological quirk of the human brain.

As a web and digital designer, I had to be very good at sales and marketing. Ultimately, my work is judged on how much traffic my website gets and how many sales it generates. loading speed. The challenge of the internet is that you have to move people into action without being able to see how they will react.To win that challenge you need to master practical psychology. .

For a long time, I believed that data was the ultimate trump card for customer acquisition. If something is empirically better, more efficient, or offers actionable insight, isn’t it always the best option someone would choose? .

Data is more challenging than stories and narratives.

The purpose of the data is to give clarity and provide an empirical way forward. Be as factual as possible to reveal the truth. I hope it changes someone’s perspective so that they think, act, or do something different. That means doing business with us.

What happens instead is shocking. People challenge the data, fill it with holes, ask more questions than before and walk away. Sales calls end with the frustrating “I have to think about it,” vague reasons, often with no specific follow-up questions. It hardly matters whether something is a fact, is empirically the best choice, or is backed up by numbers because it cannot be recognized as a fact if it goes against what you have experienced in life. . This is simply because humans are emotional creatures.

Another common mistake is to assume that the more analytical or data-driven someone is, the more effort they should put into presenting the data. Doing this is exponentially worse than presenting the data to someone who is not numerically driven. Because the more data-driven people you have, the more experience and context you have to challenge what you’re presenting.

Experience guides interpretation of data, and imagination builds trust.

The exact clarity that data can provide is exactly what data fails in sales and marketing. Because the answer has already been presented. Instead of creating scenarios in which they can all imagine how something could work, prospects leave their doubts by questioning all the reasons why it might not work based on their own biases from experience.

This is why narratives and stories work so well in persuasion, sales and marketing. A story allows a person to imagine “how” something works or is achieved. Number people do the hard work of figuring out how things work in your head. A non-analytical person is drawn into the story, understands it, and sees things in a different light. In both cases, it is the person who “sees” and hypothesizes how the pitch works, thus increasing the credibility of the pitching.

The paradox is that early in the sales process, stories create trust and data create suspicion.

The best time to use data is when prospects trust you and then justify your narrative.

The best time to use the data is after a major sales pitch, marketing collateral, or website opt-in. That is, after experiencing the narrative and emotional reasons why someone should do business with you. Importantly, data must be at least at a basic point of trust in order to be well received and accepted. is completely changed and its impact is amplified.

People choose to take the next step with you and your ideas based on their emotional connection to you. Data allows us to logically justify our decisions. For data to work effectively, trust and emotional connections must be established and followed by data. This happens because they are open to what you say and do not have a skeptical mindset to challenge your point of view.

The opinions expressed herein by Inc.com columnists are their own and not those of Inc.com.

[ad_2]

Source link

TagsbestBusinessdesignerfactsfollowgoodhopelifelightmarketingmindsetmypeoplethetimetruthviewwalkworkyou
Previous Article

New CFPB Interpretation Rules Target Digital Marketing ...

Next Article

KHN’s “What the Health?”: The Future of ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Science & Tech

    The Science Behind Nutrition Labeling The Badger Herald

    September 21, 2022
    By admin1
  • Health & Beauty

    San Diego has declared homelessness a public health crisis. “Today our county took an important step.”

    September 28, 2022
    By admin1
  • Fashion

    Margot Robbie’s Barbie Movie Press Style Is…Like Barbie’s

    July 10, 2023
    By admin1
  • Health & Beauty

    Brighten Your Smile with Up to 50% Off at Spotlight Oral Care!

    December 8, 2024
    By admin1
  • Travel & Lifestyle

    2022 World Congress: Theological Education and Liturgy in Culture

    September 16, 2022
    By admin1
  • All

    LG Brings Sustainability and Innovation to IFA 2024 with Eco-Friendly Appliances and Smart Home Solutions

    September 25, 2024
    By admin1

You may interested

  • Science & Tech

    Turing patterns, 70 years later

  • Science & Tech

    The value of reverse mentoring in the life sciences industry

  • Science & Tech

    Today’s D Brief: Biden’s speech; Attacks on US forces; State warns Americans abroad; Ukraine’s winter challenge; And a bit more.

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Caesars Unleashed – Luxury, Luck, and Legendary Escapes Await

    By admin1
    June 9, 2025

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy