Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Travel & Lifestyle
Home›Travel & Lifestyle›Indian higher education startup Sunstone raises $35M – TechCrunch

Indian higher education startup Sunstone raises $35M – TechCrunch

By admin1
August 19, 2022
433
0
Share:

[ad_1]

Sunstone, a higher education startup that works with academic institutions to help improve student employability, has raised $35 million in a new funding round as it aims to expand to more cities in India.

Sunstone founders said Friday that WestBridge Capital led the company’s Series C funding round. Alteria Capital also participated in the fundraising, bringing the total raised to date to approximately $68 million.

There are thousands of management colleges and institutions in India, but most fail to attract enough students, except for those at the top of the charts. I am struggling with

Founded in 2019, Sunstone is tackling these challenges by offering students a wide range of additional courses and helping them secure jobs, co-founder Piyush Nangru told TechCrunch in an interview.

“Universities are running at 40% occupancy. That’s the equivalent of a perishable inventory for them, which prevents them from amassing resources and lowers the quality of their education,” he said. We partner with these institutions to provide upskilling and soft skills courses, as well as campus life programs for students, to improve the quality of education for our students.”

As part of the partnership, the institution continues to provide hundreds of hours of “fundamental” classes to students. “For example, take an MBA. It’s a 900-hour program that covers core subjects like accounting, marketing, and finance. and the rest are industry-ready skills) are added to this,” he explained.

Piyush Nangru (left) and Ashish Munjal co-founded Sunstone in 2019.

Currently serving undergraduate and postgraduate students in over 40 institutions across nearly 30 cities in India, part of the value proposition of the New Delhi-based start-up is the We equalize quality and employment opportunities. partner.

Ashish Munjal, co-founder and CEO of Sunstone, said: “Sunstone is well positioned to enable this change and impact the lives of millions of students. Over the years, we have made great strides in this direction. But we still have a long way to go as the market opportunities and problems we are trying to solve are huge.”

After growing 10x in the last two years, Sunstone is now focusing on business colleges. The company is also beginning to expand into engineering and other technology areas, and that expansion is part of a plan to deploy new funding, the founders said.

“Over the past year, we have seen Sunstone grow and continue to improve the quality of education provided to all students. Recognizing that it will continue to grow and lead to significant disruption, we are excited to double down on our investment to support the company’s mission to transform the higher education sector in India.

[ad_2]

Source link

TagsBusinesseducationfridayindiaindianlifemarketingnewrunningthetop
Previous Article

Purifying membranes of viral vectors improve human ...

Next Article

Sweet Science Becomes Scott’s Add Jim’s Growing ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • All

    Sam’s Club expands retail media offerings to aid product discovery

    September 19, 2022
    By admin1
  • Health & Beauty

    City of San Diego v. Scripps Health Case Moves Forward

    August 24, 2022
    By admin1
  • Fashion

    Vaquera Spring Summer 2023 Paris Fashion Week

    September 27, 2022
    By admin1
  • All

    Traders say Prime Day 2023 went well

    July 13, 2023
    By admin1
  • CFA, Others bid Farewell to ISN Hubs Board After 4 Years of Trailblazing Pioneering Leadership

    September 15, 2023
    By admin1
  • All

    Listen On-the-Go: Discover the Magic of Audible’s Endless Stories

    November 20, 2024
    By admin1

Leave a reply Cancel reply

You may interested

  • Science & Tech

    Hampton Roads schools gain accreditation, but data shows science remains a problematic area – The Virginian-Pilot

  • Science & Tech

    Spotlight on Y: Food Science Student Wins $10,000 Grand Prize for Dairy Invention; BYU Student Designs Water Purifier to Bring Clean, Affordable Water to Pakistan

  • Science & Tech

    Data science and analytics executives in high demand

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (22)
  • Health & Beauty (1,622)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Sempolinski Focuses on Economy and Education | Celent News, Sports, Jobs

    By admin1
    September 24, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy