Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Health & Beauty
Home›Health & Beauty›News release from Ministry of Health

News release from Ministry of Health

By admin1
August 18, 2022
480
0
Share:

[ad_1]

DOH reports two more monkeypox cases in Hawaii

Posted August 18, 2022 / Newsroom

Honolulu-Hawaii Department of Health (DOH) has reported two new cases of monkeypox.

“Although the risk to most Hawaii residents remains low, localized monkeypox transmission has occurred,” said Vice State Epidemiologist Dr. Nathan Tan. “The rising number of cases in Hawaii highlights the importance of vaccination. If you are eligible, please take this step to protect yourself and our community.”

Cases in Hawaii

DOH has identified two additional cases of monkeypox.

  • Oahu residents not associated with travel. Links to previous cases are under investigation.
  • A non-resident case diagnosed on Oahu associated with travel outside Hawaii.

This brings the total number of cases reported in Hawaii since June 3 to 18.

vaccination

The JYNNEOS vaccine is available statewide to Hawaii residents age 18 and older. Immunization eligibility includes:

  • You have been in close contact with someone who has or is suspected of having monkeypox in the past 14 days.
  • Gay, bisexual, and other men who have sex with men, and transgender individuals with multiple or anonymous sex partners.
  • Individuals with severe immunocompromise (e.g., advanced or poorly controlled HIV infection, aggressive cancer treatment, high-dose steroids), or certain skin conditions such as eczema; and family members at high risk of monkeypox or A person who has a sex partner.

DOH and health care providers in each county who directly reach out to individuals at high risk of monkeypox exposure continue to vaccinate eligible individuals. Individuals eligible for vaccination can make an appointment by contacting:

provider/organization

service area

Hawaii Department of Health

Phone: (808) 586-4462

Online: health.hawaii.gov/docd/mpxvax

Kauaʻi Residents can also call (808) 241-3495

statewide

Malama I Ke Ora

Phone: (808) 871-7772

Maui

Waianae Coast General Health Center

Phone: (808) 427-0442

Oahu (Wai’anae and Kapolei Sites)

Hawaii Health & Harm Reduction Center

Phone: (808) 521-2437

Oahu (Honolulu site)

On Oahu, reservations are still being accepted at the Blaisdell Center on Saturday, August 20th and Sunday, August 21st from 9:00 am to 1:00 pm. Vaccinations are by appointment only. You can book online at health.hawaii.gov/docd/mpxvax or by calling (808) 586-4462.

DOH has received approximately 2,800 doses of JYNNEOS and continues to order the full allocation to Hawaii from the federal government. More than 1,000 doses have been administered.

JYNNEOS is a series of two doses approximately four weeks apart. The vaccine can be administered between layers of skin or under the skin, similar to the tuberculosis skin test. Both routes of administration offer the same high level of protection.

contagion; infection

Monkeypox is spread primarily through close contact with bodily fluids, diseased material, or items used by monkeypox patients. Monkeypox can spread through large droplets. These droplets can typically only travel a few feet, so prolonged contact is required.

Nationwide, the current cases are spread through the social networks of mostly gay, bisexual, and other men who have sex with men. A case has been reported. However, anyone who has close contact with a monkeypox patient is at risk of infection, regardless of sexual orientation or gender identity.

examination and treatment

People with monkeypox symptoms, such as flu-like symptoms, swollen lymph nodes, new or unexplained rashes or sores, should call their healthcare provider right away. Testing and treatment are available through your health care provider.

# # #

PDF: DOH reports two more monkeypox cases in Hawaii

[ad_2]

Source link

Tagsbookcommunityfamilygayhawaiihealthmennewnewspeoplesaturdaysundaythetravelyou
Previous Article

If you don’t go digital, you risk ...

Next Article

K-pop group’s mark of luxury and trend ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Gift GuidesTravel & Lifestyle

    Menkind’s Customer Favorites: Top 5 Bestsellers That Define Great Taste and Diverse Interests

    February 19, 2024
    By admin1
  • Science & Tech

    Sexual harassment plagues Antarctic research.chemistry

    September 2, 2022
    By admin1
  • Fashion

    Luxury fashion e-commerce retailer Aza Fashions partners with N7-The Nitrogen platform to boost website performance by 40%

    September 1, 2022
    By admin1
  • Travel & Lifestyle

    The LEGO Foundation Announces New $25M Supplemental Funding for Can’t Wait Education at Global Citizen Festival, Bringing Total Giving to ...

    September 24, 2022
    By admin1
  • Travel & Lifestyle

    Sex education theme in Azerbaijan, JAMnews

    September 24, 2022
    By admin1
  • All

    Digital Marketing Program Relaunches to Help Small Businesses Sharpen Media Skills – Peninsula News Review

    August 10, 2022
    By admin1

Leave a reply Cancel reply

You may interested

  • Science & Tech

    Ukraine downed a hypersonic missile with a Patriot. What that says about the future of weapons

  • Science & Tech

    Earth’s inner core appears to be slowing its rotation

  • Science & Tech

    Science-based tips on how to give effective feedback

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • The B2B marketplace boom has already begun

    By admin1
    August 22, 2023

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy