Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Fashion
Home›Fashion›2022 Emmy Awards Fashion: See Photos of the Best Looks

2022 Emmy Awards Fashion: See Photos of the Best Looks

By admin1
September 13, 2022
446
0
Share:

[ad_1]

lian italy

September 13, 2022 GMT

NEW YORK (AP) — Hannah Waddingham wore Dolce & Gabbana on Monday with a pair of dazzling high-top sneakers, while Elle Fanning wore a gown designed by Sharon Long from her show The Great. I went to Hollywood. Sticky Los Angeles humidity.

Waddingham in “Ted Lasso” showed off comfy white shoes under a corseted, strapless pink look. Fanning’s appearance was black and pink with an embellished chest.

“I’ve always been inspired by the glamor of 1950s Old Hollywood,” said Fanning.

‘Abbott Elementary’ Sherrill Lee Ralph had a fashion failure before arriving at the Emmys.

“A designer gave my co-star and me the same sketch of the same gown,” she said, referring to it when Lisa Ann Walter showed Ralph what she wore to the awards on set. I found

“Until five days ago I didn’t have a gown, so Brandon Blackwood stepped up. He was in Japan and started rendering the gown on Pacific Flight,” Ralph said.

Ralph shone in a black velvet strapless gown with an orange underside and thigh slit. She carried a small orange purse.

All the stars are out.

Working with her stylist, Law Roach, Zendaya wore a classic black strapless corset look with a full skirt and a dainty bow at the waist. She wore Bvlgari jewellery, including a fresh, young white diamond choker with a 4.45 carat stone on top. She had pockets in her too.

Connie Britton wore a soft pink goddess gown by Monique Lhuillier. Britt Lower in “Severance” wore a golden Venetian beaded gown with matching elbow length gloves. The top had a cutout and a narrow, decorated strap.

“I felt like wearing outer space. I love fabrics and my mom was a home economics teacher. It feels great,” Lower told the Associated Press.

People’s style and beauty director Andrea Rabinthal said pink carried the evening, but many other colors brightened up the carpet.

“Pink seems to maintain its dominance as a red carpet color. There are a lot of stars who are drawn to different shades of pink,” she said.

Not Rachel Brosnahan. She stood out in a beautiful purple plunging Pamela Rowland column gown, adorned with a tulle and pearl floral bow appliqué from the designer’s Fall 2022 collection.

Laverne Cox and Himesh Patel helped kick off the fashion parade. She wore a bold black armor-inspired Jean Paul Gaultier couture her mini, and he eschewed his usual black for the evening and wore a white printed tuxedo his jacket. Sarah Thompson (“Yellowjackets” writer) royal blue, marigold yellow and more – colors took the night away.

“I wear very warm, three-piece suits. I love this suit, but I didn’t expect it to be hot,” Patel said.

Natasha Rothwell of “The White Lotus” chose red for her balloon short-sleeved gown and Fashion Carpet favorite pocket! It was Safiyaa custom silk taffeta. Megan Starter also opted for red in a sheer dress that complimented her curves, Jen Tullock in “Severance” was in his zone, and a thigh-high slit and structured sleeve numbers by Thierry Mugler He wore drop pearl earrings.

“I’m a fan of his line. It’s elegant, but it also has a sense of humor,” says Tullock.

The “Hux” starter wore velvet burnt out by Norma Kamari. She had a fake red rose pinned between her breasts.

“It took my breath and my words. Kind of a sexy dress. Wild as I am,” she said.

It girl and Squid Game Louis Vuitton ambassador Jeong Ho-young wore the perfect look for the brand’s versatile, multi-colored figure. It was a custom tweed design with all-around sequins. Her jewelry was also Louis Vuitton.

“I still can’t believe it. It hasn’t caught on yet, but I’m just going to enjoy the day and cherish the moment,” she said of her nomination.

Reese Witherspoon wore blue sequins to match her blue and sunglasses. Around her neck was a Tiffany & Co knockout aquamarine, blue zircon and diamond choker. Amanda Seyfried wore a pink bodice hugger from Armani Prive and paired it with a platinum Cartier drop her diamond earrings.

“Tonight I’m a mermaid,” said Seyfried.

Another fresh surprise for Lavinthal? Men who dismissed black for an all-white tuxedo, including Nicholas Brown in “Succession” in a Christian Dior double-breasted tuxedo. , chose white with Seth Logan. Speaking of white, Jean Smart also decided on it, with an elegant collar that fell off one shoulder. decorated with lilies of the

Washington’s black tights were head-scratching: Kaley Cuoco’s high-low Dolce & Gabbana tutu style and Julia Garner’s Gucci navel cutout in a dark brown velvet look with silver crystals.

“I thought I’d seen all kinds of cutouts on the red carpet, but the navel cutout was something new,” said Rabinthal.

One of Lavinthal’s highlights was Lily James in a copper Versace.

“It was exactly 2022, but it could have just come right off the runway in the ’90s with chain mail and sculpted cups.

Smart’s gown was made by Christian Siriano, as was Laura Linney’s white look.

Robin Sheede also wore a stunning pastel blue Siriano, and Jerrod Carmichael wore a long white fox fur coat.

“This was Puff Daddy’s coat. He wore it in the video,” said the Saturday Night Live comic.

Carmichael was shirtless under fur and sporting a sunburst platinum necklace. His black satin trousers were accented with pointed tops on his white underwear.

Another Siriano fan? Melanie Lynskey in “Yellowjackets”. Hers was mint green with sheer overlays that made her feel “half princess and half bad (expletive).” About her designer, she said: I feel like he made something for me, for my body. ”

Harper’s Bazaar’s fashion news director, Rachel Tashjian, saw another trend.

“This year’s standout looks on the red carpet proclaimed a turning point in the celebrity style hinted at at the recent Venice Film Festival. Instead, stars gravitate toward true elegance, even classicism. ‘ she said.

She often pointed out Zendaya, who is a risk taker.

“Here she wore a very traditional strapless Valentino gown and tied up the hair of a late 1950s socialite.

Similarly, Fanning wore a “very classic 1950s-style haute couture dress with an old-school hairstyle.” she said.

Another of her highlights was Issa Rae in a fitted and flattering Sergio Hudson look on Sunday’s runway. Her absolute favorite, however, was Lizzo in a “gorgeous red Giambattista Valli gown – a dazzlingly sophisticated and glamorous statement.”

Among other standouts was Atelier Prabal Gurung’s Ariana DeBose. It was the lavender silk chiffon that draped the cloak with her hands.

Colman Domingo of “Euphoria” was already a winner when he walked the carpet. He won an Emmy Award as Guest Actor in the Drama His Series at the previous Creative Arts Awards.

“I was celebrating all week to the point where I had to wake up and take a few ibuprofen pills,” he said.

Domingo wore an open brocade jacket and matching pants.

“I want to feel like a king,” he said.

Domingo carried a platinum-encrusted, battery-powered fan to avoid the muggy humidity, which is uncommon in Los Angeles.

Mark Indelicato was like a red club. Indelicato’s hair was bright red, and his black tuxedo showed a long, parted tail like a train. Phil Dunster of “Ted Russo” paired a burgundy tuxedo with black lapels, while Russo’s co-star Brett Goldstein stayed black.

Emily Heller, on the other hand, went in a different direction. She had a “Kick Me” sign on the back of her short floral dress and a bit of toilet paper stuck to one of her shoes.

___

Beth Harris, a writer for the Associated Press in Los Angeles, contributed to this article.



[ad_2]

Source link

Tagsbeautifulbeautyblackbluedesignfashiongirlhairhomejapanlooklovemenewnightpinkredsketchstylevideo
Previous Article

Nevada Supreme Court rules against vote initiative ...

Next Article

WI schools face a shortage of mental ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Science & Tech

    The best heroines of science fiction

    September 26, 2022
    By admin1
  • All

    How to organize a goal-focused marketing team

    September 15, 2022
    By admin1
  • Fashion

    Fashion: Anti-fit: The right fit

    August 26, 2022
    By admin1
  • Travel & Lifestyle

    After too many mail-in ballot denials, Texas finally stepped up voter education

    September 6, 2022
    By admin1
  • Travel & Lifestyle

    How AI Could Bring Big Changes to Education — And How to Avoid Worst-Case Scenarios

    November 14, 2023
    By admin1
  • Fashion

    Go on, it’s okay to flaunt the old-fashioned rules – Orlando Sentinel

    August 28, 2022
    By admin1

You may interested

  • Science & Tech

    When should you use your TV over the monitor?

  • Science & Tech

    Auburn University Dedicates Tony and Riveraine Culinary Science Center

  • Science & Tech

    ‘Quite the eerie feeling’: Navy divers complete search for remains in Lahaina Harbor

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (17)
  • Travel & Lifestyle (1,755)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Pandemic preparedness and response: exploring the role of universal health coverage within the global health ...

    By admin1
    September 27, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy